SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005897 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005897
Domain Number 1 Region: 54-191,367-583
Classification Level Classification E-value
Superfamily RNI-like 6.04e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.06
Further Details:      
 
Domain Number 2 Region: 667-816
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-37
Family Toll/Interleukin receptor TIR domain 0.0000487
Further Details:      
 
Domain Number 3 Region: 268-387
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.0000116
Family Outer arm dynein light chain 1 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005897   Gene: ENSSSCG00000005503   Transcript: ENSSSCT00000006051
Sequence length 841
Comment pep:known chromosome:Sscrofa10.2:1:289775822:289785847:1 gene:ENSSSCG00000005503 transcript:ENSSSCT00000006051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPRIRLAVATIPAMAFLSCLRSESWDPCVQVVPNISYQCMELNFYKIPDNIPTSVKILD
LSFNYLSHLDSNSFSSFPELQVLDLSRCEIQTIDDDAYQGLNYLSTLILTGNPIQSLALG
AFSGLPSLQKLVAVETNLASLEDFPIGHLKTLKELNVAHNHIHSFKLPEYFSNLPNLEHL
DLSKNKIENIYHEHLQVLHQVPLLNLSLDLSLNPLNFIEPGAFNKIRLNGLTLRSNFNSS
DVMKTCIQGLAGSKINQLVLGEFKNERNLESFDKSVLEELCNLTLEQFRIAHFGEFPDDV
SDLFNCLANASVISLLSLNLRGLEALPNDFRWQHLEVVNCKLQQFPALKFNSLKKFVFKD
NKHMHTFTEINLPNLQFLDLSGNHLSFKGCCSHNEFGTTKLKHLDLSFNEIITMKSNFMG
LEQLEYLDFQHSSLKQANDFSIFLSLRNLHYLDISYTNIHVVFRGIFAGLVSLQTLKMAG
NSFQNNLLPDVFTDLTNLILLDLSKCQLEQVSQRAFHSLPRLQVLNMSHNRLLFLDTLPY
KPLHSLRILDCSYNLIVASKEQELQHLPRSLAFLNLTKNDFSCACEHQTFLQWVKDQKQL
LVGAEQMVCTQPLEMQDLPVLSFRNATCQISEAVISASVLTFLLVSVAGILVYKFYFHLL
LFVGCKKYGRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFHLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLRSHAGIIFIVLQKLEKSLL
RQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLKKALLDGKPWSPEGTEDSESNQHDTTAF
T
Download sequence
Identical sequences F1SMI0
9823.ENSSSCP00000005897 NP_001106510.2.46622 ENSSSCP00000005897 ENSSSCP00000005897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]