SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006105 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006105
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily EF-hand 3.68e-43
Family Calmodulin-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006105   Gene: ENSSSCG00000005698   Transcript: ENSSSCT00000006267
Sequence length 160
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:304186077:304192568:1 gene:ENSSSCG00000005698 transcript:ENSSSCT00000006267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALS
VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVD
RIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091H5H0 D2H171 F1MZQ0 F1PET6 F6WGJ6 G1N134 G9KCV0 H0XKR7 L5K7C3
ENSSSCP00000006105 ENSBTAP00000011496 ENSMGAP00000005178 9615.ENSCAFP00000029561 9823.ENSSSCP00000006103 9823.ENSSSCP00000006105 ENSBTAP00000011496 ENSCAFP00000029561 ENSMGAP00000005178 ENSOGAP00000016707 ENSPVAP00000003345 ENSSSCP00000006105 ENSOGAP00000016707 XP_010135997.1.100080 ENSCAFP00000029561 ENSCJAP00000037900 ENSPVAP00000003345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]