SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006413 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006413
Domain Number 1 Region: 207-287
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000288
Family DEATH domain, DD 0.026
Further Details:      
 
Domain Number 2 Region: 36-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000157
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000293
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 292-366
Classification Level Classification E-value
Superfamily DEATH domain 0.00000559
Family Caspase recruitment domain, CARD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006413   Gene: ENSSSCG00000027762   Transcript: ENSSSCT00000006589
Sequence length 401
Comment pep:novel chromosome:Sscrofa10.2:4:20920744:20949267:1 gene:ENSSSCG00000027762 transcript:ENSSSCT00000006589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLLCCALVFLDISIKWTTQETFPPKYLHYDPETSKQLMCDKCPPGTSLKQHCTARRKT
VCAPCPDHYYTDSWHTSDECLYCTPVCKELQYVKQECNRTHNRVCECEEGRYLELEFCLK
HRSCPPGFGVLHAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSALGLLLTQKGNAT
HDNTCSGSSESTHKCGIDVTLCEEAFFRFAVPTKLTPNWLSVLVDNLPGTKLNAESVERI
KRRHSSQEQTFQLLKLWKHQNKDQDMVKKIIQGIDLCENSVQKHIGHMNLTFEQLRILMQ
SLPGKKVPTEDIEETVKMCKSSEQILKLLSLWRIKNGDQDTRKGLMHALKHLKTYHFPKT
VTQSLKKIIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences ENSSSCP00000006413 9823.ENSSSCP00000006413 ENSSSCP00000006413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]