SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006570 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006570
Domain Number 1 Region: 112-164
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000955
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006570   Gene: ENSSSCG00000006159   Transcript: ENSSSCT00000006753
Sequence length 304
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:62079660:62084032:1 gene:ENSSSCG00000006159 transcript:ENSSSCT00000006753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GSAFGHHPHVAHPLLLPQNGHGNAGTTASPTEPHHQGRLATAHPEAPALRAPPSGGLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF
Download sequence
Identical sequences F1RWM2
9823.ENSSSCP00000006570 ENSSSCP00000006570 XP_001928567.2.46622 ENSSSCP00000006570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]