SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006612 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006612
Domain Number 1 Region: 680-875
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-75
Family Sec7 domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 437-620,1133-1145,1179-1522
Classification Level Classification E-value
Superfamily ARM repeat 1.54e-26
Family HspBP1 domain 0.095
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000006612
Domain Number - Region: 79-170,268-326,404-456,486-562
Classification Level Classification E-value
Superfamily ARM repeat 0.0181
Family Mo25 protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006612   Gene: ENSSSCG00000006201   Transcript: ENSSSCT00000006796
Sequence length 1840
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:73526342:73678155:1 gene:ENSSSCG00000006201 transcript:ENSSSCT00000006796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQSPPHGEAKAGSSTLPPVK
SKTNFIEADKYFLPFELACQSRCPRIVSTSLDCLQKLIAYGHLTGNAPDSTTPGKKLIDR
IIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYNIYLASKNLI
NQTTAKATLTQMLNVIFARMENQALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYL
PPQTLDPVSQEHEGDLDSHTNDVDKSLQDDTEPENGSDISSAENEQTEADQATAAETLSK
NDILYDGENHECEEKPQDIVQSLVEEMVNLVVGDTGERTTINASADGNIGTIEDGSDSEN
IQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKFSHILQKDAFLVFRS
LCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPIFRTNEMFINAIKQYLCVAL
SKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFDHKWMVI
QTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNIQELSLR
KKGLECLVSILKCMVEWSKDQYVNPNSQTTLGKEKPSEQETSEIKHPETINRYGSLNSLE
STSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFTKKPKRGIQYLQEQGMLGTT
PEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRMFLEGFR
LPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTK
EQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSSKQNVASEKQRRL
LYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQDCDD
TEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNIDTIKTL
ITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSLTGTKDQAPD
EFAGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCA
VSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPNEDVAIF
AVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQMVNSQAA
NIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTLVFEKHFPATIDSFQDAVKCLSE
FACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVRGWFPILFEL
SCIINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQQTEKAE
WMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVI
LNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPASGETAPPPLSPVNEKQLDTVSQKS
VDIHDSIQPRSADNRQQAPLASVSTVNEEASKIKSIAKFPEQKLFAALLIKCVVQLELIQ
TIDNIVFFPATSKKEDAENLAAAQRDAVDFEVRVDTQDQGMYRFLTSQQLFKLLDCLLES
HRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYTDESRASAWDE
VQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDDRFKAHASFYYPLLCE
IMQFDLIPELRAVLRRFFLRIGVVFQISQPPEQELGINKQ
Download sequence
Identical sequences ENSSSCP00000006612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]