SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007154 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007154
Domain Number 1 Region: 1524-1770
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.19e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 840-972
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 641-771
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000973
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 155-287
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 5 Region: 373-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 487-619
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 2-173
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 349-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 9 Region: 968-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000399
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 1009-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000768
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 1128-1160
Classification Level Classification E-value
Superfamily Notch domain 0.0000000876
Family Notch domain 0.0015
Further Details:      
 
Domain Number 12 Region: 768-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family EGF-type module 0.022
Further Details:      
 
Domain Number 13 Region: 1080-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 14 Region: 1207-1238
Classification Level Classification E-value
Superfamily Notch domain 0.000000288
Family Notch domain 0.0034
Further Details:      
 
Domain Number 15 Region: 318-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000007154
Domain Number - Region: 1170-1201
Classification Level Classification E-value
Superfamily Notch domain 0.000968
Family Notch domain 0.0084
Further Details:      
 
Domain Number - Region: 822-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00503
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 621-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0534
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007154   Gene: ENSSSCG00000006709   Transcript: ENSSSCT00000007349
Sequence length 2175
Comment pep:known chromosome:Sscrofa10.2:4:110927013:110985928:1 gene:ENSSSCG00000006709 transcript:ENSSSCT00000007349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPKGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCT
PGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYK
GADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQND
ATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNSGQCVDKVNRFQCLCPPGFTGPV
CQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGKNFSLCIPLLCPSEQSQTCLITQTEIV
REGLEMIRKGDVPISFLSDCLKNGFLKDFKPDYACDCFPHFAGVNCEINFDDCASNPCVH
GVCVDGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCMCPEGPHHPS
CYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSDPCQNGGTCDNLV
NGYRCTCKKGFKGHNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAP
CSPNPCENAAVCKEAPNFESYTCLCAPGWQGQRCSVDIDECISKPCMNHGLCHNTQGSYM
CECPPGFSGMDCEEDIDDCLANPCQNGGSCIDGVNTFSCLCLPGFIGDKCQTDMNECLSE
PCKNGGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGLNSFSCLCPVG
FTGPFCLHEINECNSHPCLNEGICVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKG
TCVQEKAESRCLCPSGWAGAYCDVPSVSCEVAASHRGVPVDRLCQHSGVCINAGNSHHCQ
CPLGYTGSYCEEQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPC
QNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGF
AGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNG
GTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCKKGEQCVHTASGPRCFCPNPQDCES
GCASSPCQHGGSCYPQRQPPYYSCQCSPPFWGSHCELYTAPPSAPPATCLSQYCADKARD
GVCDEACNSHACQWDGGDCSLTMENPWANCTSPLPCWDYINNQCDELCNTAECLFDNFEC
QGNSKTCKYDKYCADHFRDNHCDQGCNSEECGWDGLDCAGDRPENLAEGTLVIVVLMPPE
QLLQDARSFLRALGTLLHTNLRIKRDSQGDLMVYPYYGEKSAAMKKQKMTRRSLPGDQEQ
EVAGSQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPKRT
QLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVG
LKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEA
ADIRRTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSA
NIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHA
AVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDH
GKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANR
DITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKH
TPMGKKSRRPNAKNAVPTSLPNLAKEGKDAKGNRRKKSLSDKGQLSESSVTLSPVDSLES
PHTYVSDTTSSPMITSPGILQASPNPMLAPAAPPAPVHAQHALSFSNLHEMQPLAHGTST
VLPSVSQLLSHHHIVPPGSSSAGSLGRLHPVTVPADWMNRVEVNETQYNEMFSMVLAPAE
GTHPGITPQSRPPEGKHLTTSREPLPPIVTFQLIPKGSIAQPAGAAQPPSNCPPAVAGNL
PTMYQIPEMARLPSMAFPTGMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSN
AAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPG
THMSEPPRGNMQVYA
Download sequence
Identical sequences ENSSSCP00000007154 ENSSSCP00000007154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]