SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007218 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007218
Domain Number 1 Region: 1015-1104
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 835-937
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-24
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 396-498
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-23
Family PDZ domain 0.0000683
Further Details:      
 
Domain Number 4 Region: 698-810
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 551-662
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-18
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 6 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 289-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000371
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000169
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000407
Family PDZ domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007218   Gene: ENSSSCG00000006767   Transcript: ENSSSCT00000007413
Sequence length 1468
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:117024784:117266451:-1 gene:ENSSSCG00000006767 transcript:ENSSSCT00000007413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGSEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAVNGSGNAENRERHSEASDWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQADPGASKPDVEKSHFTRDPSQLKGILVRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDNEDPVVDIVAATPVINGQPLTKGETCMSTQEFKSGAVILDQ
NGKSGHTLISDRLNGPVDLSEQRASMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTEKKENSGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFLSTQNGSPRLNRAEV
PARPAPQEAYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVG
DHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVVAEEEHLGPPSGTNSARQSPALQHRP
MGQSQANHLPGDRSATEGEVGKDVPTSYRHSWSDHKHLAQPDTATISVVGGRHNQSLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDVNNPSSSNVIYDEQSSFPPSSHSASIF
EESQVPVTEESLMRVQICEKAEELKDIVPEKKSTLNEHQSDIKHQSLLHKNVNKRDPPNS
HGHGDKKNLLKAENGVTQRGRSASPKKSASRHSEEHLEKIPSPLKNDPKRRPRDRSLSPR
KGENKSCQTGPDHCRKGRGRSSSPKQQPKTEGSKDQSSMSRRAGGHASDHAEQIADRKER
SGVTRKDATQSQLGKSRARSPEKKSKRMEEKSLPSRKTNNISSRVVSENDKGKKATLGET
SSSKDETGENVKRAEKKLKQQPEERMVTNKIEDHKGKELETADKNKESRGFKPESGSPAK
KTPITPGPWKVPSASRATGTTGVAEKRL
Download sequence
Identical sequences A0A287AK47
ENSSSCP00000007218 ENSSSCP00000007218 XP_001925162.4.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]