SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007948 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007948
Domain Number 1 Region: 641-836
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-73
Family Sec7 domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 405-587,1096-1497,1655-1762
Classification Level Classification E-value
Superfamily ARM repeat 4.06e-27
Family PBS lyase HEAT-like repeat 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007948   Gene: ENSSSCG00000007460   Transcript: ENSSSCT00000008164
Sequence length 1792
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:56982745:57082783:1 gene:ENSSSCG00000007460 transcript:ENSSSCT00000008164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTVLQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPVHSKPQSPVIQAAAVSPKFSRLKQSQAQS
KPTTPEKTELTNGEHARSGSGKVSVENGDALRERGPSLSVTCLPNHGTEDGAQEVVKEIL
EDVVTSAVKEAAQKHGLTEPERVLGELESQERAVPPAADENPQTNGVADDRQSLSSADNL
ESDAQGHPVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLS
VLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQ
IEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERL
VNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQ
ERPTDQEMGDGKGLDLARRSSVTSMESTVSSGTQTAVQDDPEQFEVIKQQKEMIEHGIEL
FNKKPKRGIQYLQEQGMLGTSVEDIAQFLHQEDRLDSTQVGDFLGESMKFNKEVMYAYVD
QLDFCDKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLA
YSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETK
EHTIATKSTKQSVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPM
FKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSL
LTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRY
LSGSGREREGSLKGHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVD
RIFTGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSR
IWHVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKK
NRSPTIRDMVIRCLAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVT
TIFQHHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTS
DDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQD
LFRIVFRIFDNMKLPEQQSEKSEWMTTTCNHALYAVCDVFTQFYEALNEVLLSDIFAQLQ
WCVKQDNEQLARSGTNCLENLVISNGEKFSPAVWDETCNCMLDIFKTTIPHILLTWRPVG
MEEDPSEKHLDVDLDRQSLSSIDKNASERGQSQLSNPTDDSWKARPYANQKLFASLLIKC
VVQLELIQTIDNIVFYPATSKKEDAEHLVAAQQDTLDADIHIETEDQGMYKCMSSQHLFK
LLDCLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDE
NRRDSWEEIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHAS
MYYPYLCEIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPGTLSPIW
Download sequence
Identical sequences ENSSSCP00000007948 ENSSSCP00000007948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]