SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008421 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008421
Domain Number 1 Region: 5-40
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000153
Family BAFF receptor-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008421   Gene: ENSSSCG00000007888   Transcript: ENSSSCT00000008643
Sequence length 178
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:32126183:32130379:1 gene:ENSSSCG00000007888 transcript:ENSSSCT00000008643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQCYQNEYFDRLLIACKPCRLRCSNTPPVTCQHYCNTMKGTNVILWTCLGLSLIVSLT
VFILMFLLRKRSSGPLRDELRNPGSVPQKGAGADLGNGSEGRMGAETLLSRGLEYTVEEC
TCEDCVQSEPKVDSDHFFPLPAMEEGATILVTTKTNGYCSSLLAAESALALEKSISTR
Download sequence
Identical sequences A0A287BN35
ENSSSCP00000008421 XP_003124635.1.46622 ENSSSCP00000008421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]