SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008664 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008664
Domain Number 1 Region: 7-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 197-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 346-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000012
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008664   Gene: ENSSSCG00000008114   Transcript: ENSSSCT00000008890
Sequence length 405
Comment pep:novel chromosome:Sscrofa10.2:3:48138885:48143316:-1 gene:ENSSSCG00000008114 transcript:ENSSSCT00000008890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CARVSSVFQDPMTFEDVAVEFTQWEWEQLDTAQKDLYREVMLENFKNLASLGFPVSKPYV
ICQLEEGEEPCTVEREISTGAHSGDSSLQSLDLHCVSFFFFPPLDWERRPRAKESMPTSV
EKHIRDELWFSKLEAAWGCDNQLEMHPQKQERPVKEMSSSHKFTTSLRKDHEWRRNNSLR
THSGKKSCKCSECGKLFHFQSELRRHQRCHTGEKPYECSECGRAFGHISSLIKHQRTHTG
EKPYECSECRAFSQSSSLFLHYRFHTGEIPYKCNECGRAFGHTSSLIKHQRTHTGEKPYE
CKECGRTFSQSSSLIVHTGEKPYKCNRCGRAFSQSSSLTQHYRFHTGEKPYKCNECGRAF
AHTASLIKHQKSHAGKPYEFSQCGKTQRTHIIQHQTVYDGDKPFQ
Download sequence
Identical sequences ENSSSCP00000008664 ENSSSCP00000008664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]