SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008794 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008794
Domain Number 1 Region: 64-367,534-569
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.68e-49
Family FAD-linked reductases, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008794   Gene: ENSSSCG00000008237   Transcript: ENSSSCT00000009020
Sequence length 611
Comment pep:known chromosome:Sscrofa10.2:3:62309275:62323100:-1 gene:ENSSSCG00000008237 transcript:ENSSSCT00000009020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSLLLLAALLLAVLGQVYKWLFAGSSPNPFSEDVKRPPAPLVTDKEARKKVLKQVFSV
NRVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKDGLEFDTGIH
YIGRMEEGSFGRFILDQITEGQLDWATLSSPFDIMVLDGPNGRKEFPMYTGKKAYVQGLK
EKFPQEEAAIDKYIKLVKMVSSRASHAILLKILPLPLAQFLSKYGLLTRFSPFLRASTQS
LAKVLQQLPASPELRAVLSYIFPTYGVTPSHSTFAMHALLVDHYLKGAFYPKGGTSEIAF
HTIPVIQRAGGAVLTRAPVQSILLDSAGKACGVAVKNGQELVNIFCPVVISDAGLFNTYE
HLLPEKARSLPGVQRQLGAVRPGLSIFSVFICLRGTKKDLGLWSTNYYVYFDTDMDKAME
HYLSLPRDKAAAHMPLLFIASPSSKDPTWEDRFPDRSTLIVLVPTSYEWFEEWRDEPKGK
RSSDYETLKSSFVEASLSVVLKLFPQLEGKVDSVTGGSPLTTQFYLAAPRGACYGADHDL
SRLHPHVMASMRAQSPIPNLYLTGQDIFTCGLMGALQGALLCSGAILKRNLYSDLWKLGS
KIQAQKNKKKN
Download sequence
Identical sequences F1SVB2
XP_003124992.1.46622 ENSSSCP00000008794 9823.ENSSSCP00000008794 ENSSSCP00000008794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]