SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008961 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008961
Domain Number 1 Region: 154-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000534
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 266-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000711
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 297-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000727
Family EGF-type module 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008961
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0002
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 338-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000902
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008961   Gene: ENSSSCG00000008397   Transcript: ENSSSCT00000009194
Sequence length 498
Comment pep:known chromosome:Sscrofa10.2:3:90132132:90197713:1 gene:ENSSSCG00000008397 transcript:ENSSSCT00000009194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKVLFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPAAEGVGAAANAAAASGAGTGGVAASGMATSA
VVPGGGFVASAAAEVQTSRNNFVIRRNPADPQRIPSNPSHRIQCATGYEQSEHNVCQDID
ECTAGTHSCRADQVCINLRGSFTCQCPPGYQKRGEQCVDVDECSIPPYCHQRCVNTPGSF
YCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDI
DECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHG
GFRCYPRNPCQDPYVLTSENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQA
TTIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVDLEMLTVNSIGT
FRTSSVLRLTIIVGPFSF
Download sequence
Identical sequences F1SQL2
NP_001231190.1.46622 ENSSSCP00000008961 ENSSSCP00000008961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]