SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009944 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009944
Domain Number 1 Region: 499-737
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000123
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009944   Gene: ENSSSCG00000009319   Transcript: ENSSSCT00000010210
Sequence length 887
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:5173861:5301089:1 gene:ENSSSCG00000009319 transcript:ENSSSCT00000010210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGGGLPPPSAAASSSSSSLAAAVAVVAPPGVGGVPGGAAAGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPGAGFPPGAVPGGGAGPPPGPKKPDLG
GPGAGAAVGGGGGSGVLDGPRLAIPGIDGGALTESSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYAGHDPLISPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGSA
SRLSNVSQSHMSAFSQVFSHPSLGTPAAAALAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPASYMVPSSASTPVNHPVPQTPSSGQVIQKETVGGTTYFYTDSTPAPVSSVVFPN
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYH
SLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMW
KKIQHSNIVTLREVFTTKAFSEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
DGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVG
VFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTIN
YSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRL
FRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL
Download sequence
Identical sequences ENSSSCP00000009944 ENSSSCP00000009944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]