SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011810 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011810
Domain Number 1 Region: 1121-1316
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 909-1032
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-31
Family Pleckstrin-homology domain (PH domain) 0.000000552
Further Details:      
 
Domain Number 3 Region: 19-47,76-147
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011810   Gene: ENSSSCG00000011074   Transcript: ENSSSCT00000012118
Sequence length 1928
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:56044599:56132190:1 gene:ENSSSCG00000011074 transcript:ENSSSCT00000012118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSDEVSKSKDGKEQSETVSPSEDETFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQ
FSYKDEENGNRGGGARKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIG
KTYSQVIALIQNSDTTLELSVMPKDEDILQVAYSQDAYLKGNEAYSGNARNIPEPPPICY
PWLPSAPSAMAQPAEAAPADSPSSKQQTSPPVLTQPSRAYRMEIQVPPSPPDVAKSNTAV
CVFNESVRTVIVPSEKVVDLLPNRNNHTVPSHRTEEVRYGRNEQTPLKVAPRTTSPPASV
PTAHLIHQTGSRSLEPSGILLKSGNYSGHSEGLSSSRAPAVDSPPVSVNHYSPNSHQHID
WKNYKTYKEYIDNRRLHMGCRTIQERLDSLRAASQSTAGYNPVVLNRTALQVRRRSTSQD
RAPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPSISFSNHRTRSWDYIEGQGET
LENIPSEHQLPDSSGERKPTYKWSGFTEQDDRRGIHERPRQQEIHKSFRGSNFTVAPSMV
NSDSRRVSGRGVGSVSQFKKIPPELKTLQPNRNFQTTCGMSQPRGVSQDRSPLVKVRSNS
LKAPSTHVTKPPSSQNSFVSIKDQRPVNHLHQNSLLNQQTWLRTESAPDHQVDTGKPPSL
SGASVKPIPPVSENAGTPDLELSGTQRNQDLNLQEAEIQQSNTVDNKDTVILREKPPSGR
QTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVHIKRMEERKASSTSPPGDSLASIP
FIDEPTSPSIDHDISHIPASAVISASTSQVPSIATVPPSLTTSAPLIRRQLSHDQESVGP
PSLDAQPSSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGIKIMDSQKSSEDSGSRKDSS
SEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKEKREQTAPSEE
EQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSTLNEED
TGVTNRDLISRRIKEYNSLMSSKAEQLPKTPRQSLSIRQTLLGAKAEPRTQSPHSPKEES
ERKLLSKEDDTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTFGVRLDDCPPAHTNRYIPL
IVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDLNVISSLL
KSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLIHDLPEHHYETLKFLSAHLKT
VAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHDWFFTEEG
AEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGVPPGDVSDSATSDSTKSKGSWGSGKDQ
YSRDLLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVFFKKENAEQCPNDIKEESKKESE
TVGRKQRLITSKETNTKKDTSAAKEDQGAGQRESAPAGEPSAPSCSKSPTPSRRLAVLRE
SPKPLVAPKSSFFEETGSDSGALLSTCSQASLARFPTKKSTSPDTKPSEFLATVITITSD
DATASPVPYWSNLDSSRLSPEVQSVAESRGEEADDERSELVSEGRPVETDSESDFPVFPT
ALTSERLLRGKLQEATKTSRRNSEGSEVSCTEGSLTPSLESRRQLFSSHKLIECDTLSRK
KSARFKSDSGSLGDAKNEKETPSIAKVFDVMKKGKSTGSLLTAPTRSETEKQEPTWKTKI
ADRLKLRSKAPADDMFGVGNQKPNADPAKRKNIKRRHTLGGHRDAAEISVLNFWKAQEQS
GEREGELSAVNRLKPKCSAQDLSISDWLARERSRTSAADAGDPQPESAGTLEIPTADPPL
SFQPHAVGPSSTLASTDRALLSTPPESPDQINGESFQNTIHHAGSAATAQPHKLSETPGT
KAQCHPCL
Download sequence
Identical sequences ENSSSCP00000011810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]