SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012052 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012052
Domain Number 1 Region: 37-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.61e-36
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 911-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 855-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 212-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-19
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 13 Region: 366-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 952-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000032
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012052   Gene: ENSSSCG00000011304   Transcript: ENSSSCT00000012375
Sequence length 1029
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:30725578:30745411:1 gene:ENSSSCG00000011304 transcript:ENSSSCT00000012375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHNALRQEGLVKGKDDIWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGSGEEAVALVEEL
QKDLEGPGLKVPVLVQNPDTLQEGMSTPGIALPPAATGSHISAEIHSNPLTDPVVFNLLQ
DPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQR
ALYWDVMLENYGTVTSLEWETMAENEEVTSKSSISQRADSQKGTSKRLQGGVPQVLDFGE
ECEWHISTSQWGNETKERDTLKKGSLCERDRKKRTSPEKRSQKWKEFGDSLSIDSALSES
LIGTEGKKFYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFTSKSNLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECQECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEH
KRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH
TGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEK
PYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLSVHQKTHTDEKNCECDESEKEFSQASNVHLQQKIHSMEEFSWFHNAH
ESKTEIQKI
Download sequence
Identical sequences ENSSSCP00000012052 ENSSSCP00000012052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]