SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012066 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012066
Domain Number 1 Region: 95-257
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-40
Family RUN domain 0.00068
Further Details:      
 
Domain Number 2 Region: 1267-1335
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.4e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012066   Gene: ENSSSCG00000011317   Transcript: ENSSSCT00000012390
Sequence length 1443
Comment pep:known chromosome:Sscrofa10.2:13:32200269:32239205:-1 gene:ENSSSCG00000011317 transcript:ENSSSCT00000012390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASKLASDKLRSTLLGAALKPWQGSLPVHGLLQCRAPGLQAFKAAATTVSLNHFSSCPR
SASNSGLNSHEAHSQERRPRPVTVTMASSSVESQLQRIIRDLQDAVTELSREFKDAGEPI
TDDSTSLHKFSYKLEYLLQFDQKEKATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSIS
ELRTSLGKGRAFIRYSLVHQRLADTLQQCFMNTKVTSDWYYARSPFLKPKLSSDIVGQLY
ELTDVQFDLASRGYDLDAAWPTFARRTLGPGSAAYMWRPPSRSSSMSSLVSSYLQTPEMA
SSLDLSNPLNHEALEGFDEMRLELDQLEVREKQLQERMQQLDRENQELRVTVSLQGEQLQ
GERERGRAATEDNVRLTGMVATLQKQWEIAQATQNTVKELQACLQALELGASEKEEDYRS
ALQRLESMLQPLVQELEATHSSLGRKDLHSADVPDQLDMAEQKADMALDTQRQQECVPSD
SALGIQELGAKLQALERENTQIEELNRQQSAQLEQLAKELQLKEEARASLEHQVEEMALL
REEPSGKGQEAAQLRHQLQESLAHLSSLKEELAEVKREEGQRREEKELLEQEARSLMRQL
QLLETQLAQVSQHVSDLEEQKKQLIQDKDHLSQKVGTLEQLAGQPAPDLPVVGEERKALS
STLQPACEKLEEEQQRGPWEGQTDDPTMLGGGQEEKLQQANRELEKELQNVLERNQLLEG
KLQALQADYHALQQREAAIQGSLASLESEQASIRHMGDQMEASLLAVKKAKETMRAQVAE
KEVALQCKEECRQLREQAEQCRQLAEAREGELRALEGQCRQQTQLIETLTADKGQQGLGP
PQDQASQELAAQLALTKAQLEIHQGEAQRLQAGMVDLQAKLQAALGDQEKLQSQLNVTET
ALREHKALVQQLKEQNEALNRAHVQELLQCSELEGVLQAKRAGEAQKREEELRALQEELS
QAKCTSEEAQLEHAELQEQLHRANMDTAELGIQVCALTAEKERVEGALARAIQELRDAKE
AASKEQEALAHQVAGLQQEKESLQEKLKAAEDAASSLSGLQTQVAQAEQQAQSLRESARQ
ELDTLKFQLSTEIMDYQNRLKDLGAMSEWDAPPAVWHTSSEECRSLRGQLEERSQQLQAA
EKAVEKLKATQTDMGEKLSCTNKQLAECQAALLEKEEEGAALRQDLDRTQKELEKATTKI
QKYYDRLCQEATDREKNDQKMLADLDDLNRTKKYLEERLIELLKDKDALWQKSDALEFQQ
KLSAEERWLGDTEANHCLDCKREFSWMVRRHHCRICGRIFCYYCCNNYVLSKHSGKKERC
CRACFHKLSGGPGSPDSTSSGTSQGESSPTPSSAQAPGGQGANTDCRLPNDAVFDIITDE
ELCQIQESGSSLPETPTEVDSLDPNVAEQADTDVCPAPPGRDGTGRGPRIQALRGTWKDA
TDS
Download sequence
Identical sequences ENSSSCP00000012066 ENSSSCP00000012066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]