SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012130 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012130
Domain Number 1 Region: 349-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 940-990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 833-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 4 Region: 879-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 785-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 6 Region: 472-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 7 Region: 285-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000398
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 8 Region: 524-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 9 Region: 1094-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 10 Region: 988-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 11 Region: 1142-1190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 12 Region: 437-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012130   Gene: ENSSSCG00000011377   Transcript: ENSSSCT00000012455
Sequence length 1642
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:34969985:34980934:-1 gene:ENSSSCG00000011377 transcript:ENSSSCT00000012455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWASGEQGRELRGQPRPWQLQLGLLLSVLTTALAQALAPDLPGCFRGSCYPATDLLVGR
ADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQ
RRAAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYF
SYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQN
LLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAPGA
PAHAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACKKCECHGHAHSCHF
DMAIYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPGVCRSCDCDPMGSQ
DGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGFFGLSASDALGCQRCQCDTRGTV
PGGTPCDRNSGACFCKRLVTGRGCNRCLPGHWGLSHDLLGCRPCDCDIGGALDPQCNEAT
GQCRCRQHMVGRCCEQVQPGYFRPFLDHLTWEAEEARGQVVDVVERLASPGGTPSWTGPG
FVRLREGQAMEFLVASVPRAMDYDVLLRLEPQVPEQWAELELTVQRPGPISAHSPCGHVL
PKDDHIPGTLQPGTRYMVFLRPVCLEPGVSYKLHLKLVRTGGSAQPEAPYSGPSLLIDSL
VLLPRVLVLEMFSGGDAASLERRATFERYRCHEEGLMPSKTPPSEACDPLLISLSTLLYN
GALPCQCDPQGSLSSECNPHGGQCLCKPAVVGRRCNICAPGYYGFGPTGCQACQCSPEGA
LSGLCEATSGQCPCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECDTHTGTCLGCRD
HTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCHCRA
GYTGLRCEACAPGHFGDPSRPGGRCQPCECGNIDPTDPDACDPHSGQCLRCLHHTEGPHC
AHCKPGFHGQAARQSCHRCNCNLLGTDPQQCPSPDRCNCDQSSGQCPCLSQRDLSCDRCA
PSWNLTSGRGCQPCACHPSRSRGPTCNEFTGQCHCRTGFGGRTCSECQELHWGDPGLQCR
ACDCDPRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRVV
QDLAARTRRLEQRVQELQQTGVLGAFESSFWHIQEKLSTVQGIVGSRNASAAFAAKLMDA
TEELRYRREIGEATEHLTQLEAKLTDVQDENFNANHALSSLERDGLALNLTLRQLDQHLD
LLKHSNFLGAYDSIRHAHSLSAEAERRAXTSALTVPSPVSHSAGTRHRTEVLMGAQREDF
TQHMANQQALGELSARTHTLSLTGINELVCGSPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCSGAAAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGEAQQRAQAALDKANA
SRGQVEQANRELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQHLAGEIA
ERVRSLADVDMILARTVGDVRRAEQLLKDAQRARSRAEGEKQKAETVQAALEEAQRAQGA
AQGAIQEAMVDTQDTEQTLNQV
Download sequence
Identical sequences ENSSSCP00000012130 ENSSSCP00000012130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]