SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012294 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012294
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000157
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012294   Gene: ENSSSCG00000011534   Transcript: ENSSSCT00000012624
Sequence length 412
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:67832083:67836984:1 gene:ENSSSCG00000011534 transcript:ENSSSCT00000012624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPACLPKAPGLEPGDLPGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGDLSGRNVEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPADPAPKVMDFKEKPSSLAKGSEGPGKNCVPVIQRTFPHSSGEQSGSDTD
TDSGYGGESEKSELRVEQPYFKSDHGRRFTMGERISAIKQESEEPPTKKSRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALTSFMNPDKITAPLLMPQRLPSPLPPHPAIDSSALLQALKQIPPLNLETKD
Download sequence
Identical sequences A0A287BEM0
ENSSSCP00000012294 ENSSSCP00000012294 9823.ENSSSCP00000012294 NP_001231939.1.46622 XP_020924082.1.46622 XP_020924083.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]