SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 76_10.2 > ENSSSCP00000013067

Domain assignment for ENSSSCP00000013067 from Sus scrofa 76_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000013067
Domain Number 1	Region: 255-306
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000288
Family	TSP-1 type 1 repeat	0.00054
Further Details:

Domain Number 2	Region: 133-182
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000484
Family	TSP-1 type 1 repeat	0.00047
Further Details:

Domain Number 3	Region: 185-246
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000183
Family	TSP-1 type 1 repeat	0.00079
Further Details:

Domain Number 4	Region: 75-113
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000301
Family	TSP-1 type 1 repeat	0.0025
Further Details:

Domain Number 5	Region: 309-369
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000116
Family	TSP-1 type 1 repeat	0.001
Further Details:

Domain Number 6	Region: 380-413
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000275
Family	TSP-1 type 1 repeat	0.0026
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000013067 Gene: ENSSSCG00000012278 Transcript: ENSSSCT00000013427
Sequence length	463
Comment	pep:known_by_projection chromosome:Sscrofa10.2:X:47326119:47335184:1 gene:ENSSSCG00000012278 transcript:ENSSSCT00000013427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPTQRQAPQLLLLPLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSLEDCCLNADY AFQETSSKFCMPCRPPQWSPWSAWAPCSVTCTEGSQLRHRRCVGWGGQCPENVELGTLQW QLQVALFPPTEMGGWSSWGPWAPCSATCSRGTRTRRRACDRPTPKCGGHCPGEAQESEDC DTQQVCPTHGAWAAWGPWGPCQSTCKGGPSEPVERRKRTCTAPEPSTKPPGNPCSGSAND QRMCSGLPPCPATVAGGWGPWGAVSPCPVTCGLGQTREQRSCDHPVPQHGGPFCVGEAFR THICNTAVPCPVDGEWGLWGEWSNCVRRGIKHISCQEIPGQQTRSRICKGRKFDGRRCLG EQQDIRHCYSIQRCPLKEASWSEWSTWGLCIPPCGPSPVRTRQRLCQPKLPNFPPTITPV EGQGEKNVTFWGKPLVKCDVLQGQHMMVEEKRPCLHAPPCNEP
Download sequence
Identical sequences	ENSSSCP00000013067 ENSSSCP00000013067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]