SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013465 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013465
Domain Number 1 Region: 1068-1162
Classification Level Classification E-value
Superfamily Immunoglobulin 7.22e-24
Family I set domains 0.003
Further Details:      
 
Domain Number 2 Region: 780-873
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-22
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 876-970
Classification Level Classification E-value
Superfamily Immunoglobulin 9.65e-22
Family I set domains 0.0054
Further Details:      
 
Domain Number 4 Region: 1164-1251
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-19
Family I set domains 0.0061
Further Details:      
 
Domain Number 5 Region: 324-419
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 133-227
Classification Level Classification E-value
Superfamily Immunoglobulin 6.76e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 972-1066
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-17
Family I set domains 0.0028
Further Details:      
 
Domain Number 8 Region: 422-509
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 687-777
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000139
Family I set domains 0.0055
Further Details:      
 
Domain Number 10 Region: 228-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000288
Family I set domains 0.01
Further Details:      
 
Domain Number 11 Region: 40-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000247
Family I set domains 0.0062
Further Details:      
 
Domain Number 12 Region: 593-684
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000318
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013465   Gene: ENSSSCG00000012667   Transcript: ENSSSCT00000013848
Sequence length 1340
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:123691115:123706694:-1 gene:ENSSSCG00000012667 transcript:ENSSSCT00000013848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGAMMLRTFTLFLFCMRLSLGMTPIGMTAMMQSQPELWIETNYPQAPWENITL
WCKSPSRISSKFLLLKDKTQMTWIRPSHKTFQVSFPIGALTNSNTGLYRCCYWKETGWSE
PSKALELEAPGQLPKPIFWIQAETSPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQV
PTGTVAIFSIANMTPESEGVYICRTHIQMLPTLWSEPSNPLKLIVAGLYPKPTLTAYPGP
IMAPGESLNLRCQGPIYGMTFALIRLEDLEKSFYSKKPIKNEAYFFFRALKTHDAGHYLC
FYYDGSYRGSLLSDILRIWVTDTFPKTWLLAQPSPVVQMGQNVSLWCRGPVDGVGLALYK
KGEDKPLQRLDVTSIDDDKSFFLNNVTYSDAGIYSCHYLLSWKTSIRMTAHNTVEIVVVD
KPPRPSLSAWPSTVFKLGKAITLQCRVPHPVLEFCLEWEERATSQKFSVDGDFIVSNVEG
KGTGTYSCSYRIEAQPNIWSHRSEPLKLMGPAGFLTWNYVLNEAVRLSLIMQLVALLLVV
LWIRWKCRRLRIREAWLLGTAQGVTMLFILTALLCCGLCNGVLTEETEIIMPTPKPELWA
ETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTG
SYHCHSWEEMAVSEPSEALELVGTDILPKPVISASPPIRGQELQIRCKGWLAGMGFALYK
EGAQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMY
PKPFFKTWASPVVTPGTRVTFNCSTPRQHMSFILYKDGSEIASSDRSWASPGASAAHFLI
VSAGAGDGGNYSCRYYDFSIWSEPSDPVELVVAEFYPEPTLLAQPGPVVLPGKNVTLRCQ
GAFQGMRFALLQEGTQVPLQFQSASGKSADFLLHAVGAEDSGNYSCVYYETTMSNRGSHL
SKPLMIWVTDTFPKPRLFAEPSSVVPMGQNVTLWCQGPVHGVGYILHKEIEATSVQLWGS
TSNDGAFPITNVSGASIGRYSCCYHPDWTSPIKIQPSNTLELIVTGLLPKPSLLAQPGPM
VAPGENMTLQCQGELPDSTFVLLKKGTQEPLQQQRPIGYRADFRMPAVRSEDSGIYSCVY
YLDSAPFAASNHSDSLEIWVTDKPPKPSLSAWPSSVFKLGKDITLQCRGPLPGVEFVLEH
DGEEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSEPLELVGAAGPAAQE
CTVGNIVRSTLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGDPGT
NTNSPSSISQGTSVELPVPV
Download sequence
Identical sequences ENSSSCP00000013465 ENSSSCP00000013465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]