SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013792 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013792
Domain Number 1 Region: 161-284
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 38-79,107-202
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 278-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000653
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013792   Gene: ENSSSCG00000012971   Transcript: ENSSSCT00000014178
Sequence length 443
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:5558977:5570871:1 gene:ENSSSCG00000012971 transcript:ENSSSCT00000014178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFASCLPGSLLLWTLLLLLLGAASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVSPAEHATPCLPGYEPDEQEN
CVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMSITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYAF
Download sequence
Identical sequences XP_005660736.1.46622 ENSSSCP00000013792 9823.ENSSSCP00000013792 ENSSSCP00000013792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]