SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014578 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014578
Domain Number 1 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-22
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 3 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 136-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-18
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 9 Region: 511-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 10 Region: 608-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 11 Region: 2-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-17
Family KRAB domain (Kruppel-associated box) 0.00053
Further Details:      
 
Domain Number 12 Region: 77-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000382
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014578   Gene: ENSSSCG00000021757   Transcript: ENSSSCT00000014982
Sequence length 664
Comment pep:novel chromosome:Sscrofa10.2:2:66921906:66924773:-1 gene:ENSSSCG00000021757 transcript:ENSSSCT00000014982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVAIEDVVVNFNLEEWALLNPSQKKLYKDVMWETFRNLASIGKKWEDHDIEDEYKNQGRK
LRSLVLERLCESKEGSQCAKNLSLIPKLRLKKKITGVKPYECSACGKTFMHHSSLKRHIS
HHSGHKLYEYQKYEEKPYKCKECGKAFRFRTSFQTHKRVHTGEKPYECKECGKSFMWLTT
FQRHMITHTGDTPYKCKECGKPFKWLTTFRRHIIMHTGDAPYKCKECGKVFSFLSALQIH
EKTHMGEKPYQCKQCGKAFRYRRTFQTHERTHTGEKPYECKQCGKAFISRVGLQNHERNH
SGVKFYKCKKCSKAFSYSSSLRKHERNHNGEKPYECKECGKGFIFLSSLRAHMISHSGDG
PYKCKECDKAFNTPSSFQIHVRTHTGEKPYKCKQCGKTFNWPTSIRRHERSHSGEKPYEC
KQCGKAFSCPRSFQSHERRHSGEKPYDCKKCGKAFSCPNSCRKHERSHSGEKPYECKECG
KAFSSLTKFQRHVMKHTGDGPYKCKECGKIFDCPNYFRSHERTHSVEKPYECKKCYKAFS
TPRSLRRHERTHTGEKPHACKECGKAFSYPSFLQKHERSHTGEKPYQCKQCGKAVSYLSS
LRSHERTHSGEKPYECKKCGKAFDCPSSLQNHERTHTGEKPYECKNCNKAFSRLHSLRNH
ERTH
Download sequence
Identical sequences ENSSSCP00000014578 ENSSSCP00000014578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]