SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014819 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014819
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-36
Family SCAN domain 0.0000636
Further Details:      
 
Domain Number 2 Region: 433-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000272
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 401-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000411
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 521-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000016
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 217-250
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000275
Family KRAB domain (Kruppel-associated box) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014819   Gene: ENSSSCG00000013939   Transcript: ENSSSCT00000015225
Sequence length 586
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:57953214:58026156:1 gene:ENSSSCG00000013939 transcript:ENSSSCT00000015225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPNPESSRRLFRRFCYQEAAGPQEAL
HRLWDLCRGWLRPERHTKEQILELLVLEQFLAILPREIQGWVRAQEPESGDQAVAAVEAL
EREPGRPWQWLKHCEDPVVIDDADSPPDQEQERLPSEPQSDLAKSLDTQPMALAQGPGLP
SRLSGQLSGDPVLQDTSLLQEASLRDAQQVTALQLPPNRVSPFKDMIFCFSEEDWSLLDP
AQTGFYGEFIIGEDCGVSLPPNDPAAQMDLSQGEENEPRVPELQDLQGKDISQVSYLDFP
SLEPFQVEERRKRDELQVPEFQTCQQTTLPQSTCSAGGDAPFAENSLDEEVTIEIVLSSS
GDEDSQLGPYCTDEPQSPTEKQHSLPTSHRSGMEAGSEMQTSKKSYVCPNCGKIFRWRVN
FIRHLRSRREQEKPHECSVCGELFSDSEDLDGHLEAHEAQKPFRCGACGKSFRLNSHLLS
HRRIHLQPDRLEIVKRREQVASGTVGGDSDELLAKNKAKLPYQCCECGKVFQRHDHLARH
LSNTHMDKPRPFQCRYCVKRFSQNSDLLRHERLHMKRRSKQALNSY
Download sequence
Identical sequences A0A287ASC6
XP_003123621.3.46622 XP_013842960.1.46622 XP_020939063.1.46622 ENSSSCP00000014819 9823.ENSSSCP00000014819 ENSSSCP00000014819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]