SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015508 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015508
Domain Number 1 Region: 711-787,822-911
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-35
Family RUN domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1071-1244
Classification Level Classification E-value
Superfamily RUN domain-like 4.18e-26
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 919-1016
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.56e-18
Family Lipoxigenase N-terminal domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015508
Domain Number - Region: 601-670
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0687
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015508   Gene: ENSSSCG00000014578   Transcript: ENSSSCT00000015928
Sequence length 1251
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:364339:425457:1 gene:ENSSSCG00000014578 transcript:ENSSSCT00000015928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCQYIQASKARDGARPFTSSTAEGENFEQTPLRRTFKSKVLARYPENVDWNPFDQDAVG
MLCMPKGLAFKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHM
HNAEYDVFHAPPDGQDHSGLRDGGGAPGTKLQRLNSYDISRDTLYVSKCICLITPMAFMK
ACRSVLEQLHRAVTSPQPPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYAPIVCQRPSTS
ELPLFDFPVREVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMAVAETITALMFPFQW
QHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPED
LPQFPNKLEFVQEVSEILMAFGLPPEGNLPCSESAAKLKRLRASELVSDKRNGNVAGSPL
QPYELLKENETIARLQALVRRTGVSLEKLEVREDPSSNKSLKVQCDEEELRIYQLNIQIR
EVFANRFTQMFADYEVFVIQPSQDKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLE
TQMFASFIDNKIMCHDDDDKDPVLRVFDARVDKIRLLNVRTPTLRTSMYQKCTTGDEAEK
AIELRLAKIDHTAVHPHLLDMKIGQGKYEPGFFPKLQSDVLSTGPASNKWTKRNAPAQWR
RKDRQKQHTEHLRLDNDQREKYIQEARNMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKE
CRNKTKRMLVEKMGREAVELGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSAL
WSHLLHYQENQQRKLASGSVGPSVGIFLDSERRKSDAGSAMSPLRVSLIQDMRHIQNIGE
IKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLS
FSAVDYFCFTNVFTTVLIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVL
EMTFECQNLGKLTTVQIGHDNAGLYARWLVEHVTVRNGVTGHTYKFPCGRWLGKGMDDGS
LERVLVGELLMSQPEVDERPCRTPPLQPSPSVIRRLVPVSPNSKPKLNTGQIQESIGEAV
NGIVKHFHKPEKERGSLTLLLCGECGLVSALEQAFQHGFKSPRLFKNVFIWDFLEKAQTY
YETLEQNELVPEENWHTRARSFCRFVTAINSTPRNIGKDGKFQMLVCLGARDHLLHHWIA
LLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLETSLVKGIDI
Download sequence
Identical sequences ENSSSCP00000015508 ENSSSCP00000015508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]