SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016355 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016355
Domain Number 1 Region: 528-560,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016355   Gene: ENSSSCG00000015425   Transcript: ENSSSCT00000016803
Sequence length 741
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:113991070:114028926:-1 gene:ENSSSCG00000015425 transcript:ENSSSCT00000016803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENELLAATQRYYVERPIFSHPVLQERLHKKDKISDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKGSYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPETDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVNPALIMGARRKAMKKYAKEMGNANMANAAVVKVDAEVD
GEDGTKPEEGEDEIKYPPIVIKSKFPEELQRFMPPGDNIHTIILDFTQVNFIDSVGVKTL
AVMVKEYGDVGIYVYLAGCSAQVVDDLTRNRFFENPALRELLFHSIHDAVLGSQVREAMA
ERDASAPPLQEDSEPNATPEA
Download sequence
Identical sequences ENSSSCP00000016355 ENSSSCP00000016355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]