SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016746 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016746
Domain Number 1 Region: 339-688
Classification Level Classification E-value
Superfamily L domain-like 2.72e-43
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 29-331
Classification Level Classification E-value
Superfamily L domain-like 2.98e-42
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 3 Region: 751-902
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.97e-33
Family Toll/Interleukin receptor TIR domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016746   Gene: ENSSSCG00000015801   Transcript: ENSSSCT00000017207
Sequence length 905
Comment pep:known chromosome:Sscrofa10.2:15:53840783:53852536:-1 gene:ENSSSCG00000015801 transcript:ENSSSCT00000017207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSLPCHIYSFWVLLPFWILYTTSTNKCTVRHEIADCSHLKLTQIPDDLPANITVLNLT
HNQLRRLPPANFTIYSQLTTLDGGFNTISKLEPELCQSLPLLEILNLQHNELSQLSDKTF
IFCMNLIELHLMSNSIQKIQNNPFKNLKNLIKLDLSHNGLSSTKLGTQLQLENLQELLLA
NNKISALKREELDFLGNSSLKRLELSSNQIQEFSPGCFHAIGKLFGLSLNNVKLSPSLTE
KLCLELSNTSIENLSLSNIQLYKTSNTTFFGLKQTNLSMLDLSHNSLSVIGNDSFAWLPH
LKYFFLEYNNIERLSSRSLYGLSNVKYLNLRRSFTKQSISLASLPKIEDFSFQWLKSLEY
LNMEDNNFPGIKRNTFTGLIKLKSLSLSNSFSSLRTLTNETFISLADSPLLILNLTKNKI
SKIESGAFSWLGHLKVLDLGLNEIGQELTGQEWRGLKNIVEVYLSYNRYLELTTDSFALV
PSLQQLMLRRVALRNMDCSPSPFHPLFNLTILDLSNNNIANINDELLKGLEKLQILDLQH
NNLARLWKHANPGGPVQFLKGLSHLHILNLESNGFDEIPADAFRDLSELKSIDLGLNNLN
ILPPSVFDNQVSLKSLSLQKNLITSVKKTVFGPAFQKLSNLDMRFNPFDCTCESIAWFVS
WINSTHTNISELSSHYLCNTPPQYHGLPVILFDTSPCKDSAPFELFFMITASMLLIFIFI
ILLIHFEGWRISFYWNVSVHRVLGFKEIDKQPEQFEYAAYIIHAYKDRDWVWEHFAPMEE
KDETLRFCLEERDFEAGALELEAIVNSIKRSRKIIFVITQHLLKDPLCKRFKVHHAVQQA
IEQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERINAFHHKLQVALGS
RNSVH
Download sequence
Identical sequences A0A0B8RT27 A0ENH4
ENSSSCP00000016746 ENSSSCP00000016745 NP_001090913.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]