SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017078 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017078
Domain Number 1 Region: 263-364
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.68e-29
Family Ras-binding domain, RBD 0.0051
Further Details:      
 
Domain Number 2 Region: 398-476
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000877
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017078   Gene: ENSSSCG00000016119   Transcript: ENSSSCT00000017550
Sequence length 1236
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:118236247:118297755:-1 gene:ENSSSCG00000016119 transcript:ENSSSCT00000017550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPTEPIKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGTGNSKRQMTETKAPQK
VPPSRHTSKHGTSKGLSSSSSNRISKPSHANYSLDDITAQLEQASLSMDEAAQQSVLEDT
KPLVTNQHRRTASAGTVSDAEVRSISNSSRSSITSAASSMDSLDIDKVTRPQELDLTHQG
QPITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMADDSSKTMMVDERQTVRQVLDN
LMDKSHCGYSLDWSLVETISELQMGTERIFEDHENLVENLLNWTRDSQNKLIFMERIEKY
ALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRY
FLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKYPVISY
KSSYLAFLLCPVLKEIFCWKVNSAIISIFFRTILDNSVECTREKESTYDGLSASESSELA
IKDETAFLPQESQSNHSNQSDSGVSDTQPAGHIRSQSIVSSIFSEAWKRGTQLEESSKSF
IRNLSWPYFSILSLTFPQKWISLNWFGWSNNTLQCQCPNFVPEKPLMVNSLFVINVIYST
HYFIIFSFMASLCTSMNFLKLKFMWKTKFQLLPLRFWIPGPCIENCEGTPGLAILFSPIV
MFESLIQVYSPMRIKGLYNYPNITRKAKESRGPNVLIPCVFLLLLPQSQVPNEKASTAKV
CTPAAAKTGSSNVYKAFLYVFSSITNVKNIPPLPALLDFCACPPPSTPKPFIRRPVEAQA
TMSSPPPTPPPAEAPPLKPASAAAGAPQSPPAVKAKPKWQPSSLPAPSPDFPPPPPESSL
GFPPPPPPPAAPAPAPPPPPPPPPATPTPAAAPAPDKSGSPGKKTSKTSSPGGKKPPPTP
QRNSSIKSSSCAEHPEPKRPSVDSLVSKFAAPAEPSGSPSKETPSPPAAPPPGKLNLAGV
HLPGVLQPGCVSARASVLSGRGKDSVVEFPSLPSDSDFPPPPPEIELPMPPVEIPAVFSG
GTSPKVAVVNPQPQPWSKTSVKKAPPPTRPKRNDSTRLTQAEVSEQPTTATVVPQVPTSP
KSSLSVQPGFLADLNRTLQRKSITRHGSLSSSRVSRAEPTATMDDMALPPPPPELLSDQQ
KAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW
Download sequence
Identical sequences ENSSSCP00000017078 ENSSSCP00000017078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]