SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017113 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017113
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.41e-54
Family D-ribulose-5-phosphate 3-epimerase 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017113   Gene: ENSSSCG00000016154   Transcript: ENSSSCT00000017587
Sequence length 187
Comment pep:known chromosome:Sscrofa10.2:15:124551077:124560895:1 gene:ENSSSCG00000016154 transcript:ENSSSCT00000017587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENP
GALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVH
WLRTQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAA
QKRSLDR
Download sequence
Identical sequences G3VQY8
ENSSHAP00000005593 ENSSSCP00000017113 ENSSHAP00000005593 ENSSSCP00000017113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]