SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017661 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017661
Domain Number 1 Region: 5-124
Classification Level Classification E-value
Superfamily Hormone receptor domain 9.29e-28
Family Hormone receptor domain 0.00031
Further Details:      
 
Domain Number 2 Region: 103-380
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000357
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017661   Gene: ENSSSCG00000016673   Transcript: ENSSSCT00000018152
Sequence length 410
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:46427127:46436822:-1 gene:ENSSSCG00000016673 transcript:ENSSSCT00000018152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLPQALGHVHPECDFITQLREDERTCLQAADRMANSSSGCPRTWDGLLCWPTAGPGEW
VTLPCPAFFSHFSSEPGALKRDCTTTGWSEPFPPYPEACPVPLELLTDEKSYFSTVRIVY
TTGHSVSAVALFVAIAILVALRRLHCPRNYIHSQLFATFILKAGAVFLKDAALFHSENTD
HCSFSTVLCKVSVATSHFATMTNFSWLLAEAVYLTCLLASTSPSTRRAFWWLVLAGWGLP
LLFTGTWVGCKLAFEDVACWDLDDSSPYWWIIKGPIVLSVGVNFGLFLNIIRILLRKLEP
AQGSLHTQPQYWRLSKSTLLLIPLFGIHYVIFNFLPDSAGLGIRLPLELGLGSFQGFIVA
ILYCFLNQEVRTEISRRWHGHDPELLPAWRTHAKWAKPSRSRAKVLTTVC
Download sequence
Identical sequences ENSSSCP00000017661 9823.ENSSSCP00000017661 ENSSSCP00000017661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]