SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018346 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018346
Domain Number 1 Region: 15-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.32e-29
Family Hormone receptor domain 0.0000649
Further Details:      
 
Domain Number 2 Region: 100-386
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000101
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018346   Gene: ENSSSCG00000017313   Transcript: ENSSSCT00000018849
Sequence length 415
Comment pep:known chromosome:Sscrofa10.2:12:17366143:17420526:-1 gene:ENSSSCG00000017313 transcript:ENSSSCT00000018849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRPQLRLVKALLLLGLNSISASLQDQHCESLSLASNVSGLQCNASVDLIGTCWPQSPA
GQLVVRPCPAYFYGVRYNTTNNGYRECLANGTWAARVNYSECHEILSEEKKSKVHYHVAV
IINYLGHCVSLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEV
HQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPF
PIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Download sequence
Identical sequences F1RRS6
ENSSSCP00000018346 ENSSSCP00000018346 9823.ENSSSCP00000018346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]