SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018503 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018503
Domain Number 1 Region: 364-442
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.66e-23
Family Intermediate filament protein, coiled coil region 0.00081
Further Details:      
 
Domain Number 2 Region: 129-164
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000575
Family Intermediate filament protein, coiled coil region 0.0028
Further Details:      
 
Domain Number 3 Region: 189-277
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000785
Family Myosin rod fragments 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018503
Domain Number - Region: 246-362
Classification Level Classification E-value
Superfamily Prefoldin 0.000314
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018503   Gene: ENSSSCG00000017460   Transcript: ENSSSCT00000019008
Sequence length 501
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:21879833:21886551:-1 gene:ENSSSCG00000017460 transcript:ENSSSCT00000019008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALPGSTMSLSVRTSGLSQRLSSQGGTLGRARGTSASSIGSSYGGSAFGFGGSSGGGFSA
ASMFGSGYGFGGGSGSSFAGGLGAGYGGAGYGGAGYGGAGGGDFGGLGIGFGGGSPGILS
GNDGGLLSGSEKETMKNLNDRLASYLDKVRALEEANTDLENKIREWYETRGSGTGDPRSQ
SDYSKYFPLIEELKNKIISASIANAQLILQIDNARLAAEDFRMKYENEVALCQNVEADIN
GLRRVLDELTLVRADLETQIETLNEELAYLKKNHEEELQSFRAGGPGQVSVEMDAAPGVD
LTKLLNDMRAQYEAIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRALQ
NLEIELQSQLAMKKSLEDSLAETEGDYCAQLSQVQQLIGGLEEQLLQVRADAERQNADYQ
RLLNVKARLELEIETYRRLLDGEAQGDCWDGSLYVTASTSQAPSTDSSKDPTKARKIKTI
VQEVVNGEVVSSQVQEVEELM
Download sequence
Identical sequences ENSSSCP00000018503 ENSSSCP00000018503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]