SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 76_10.2 > ENSSSCP00000019309

Domain assignment for ENSSSCP00000019309 from Sus scrofa 76_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000019309
Domain Number 1	Region: 72-109
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.000000000053
Family	TNF receptor-like	0.0048
Further Details:

Domain Number 2	Region: 110-170
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000181
Family	TNF receptor-like	0.0019
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000019309 Gene: ENSSSCG00000025094 Transcript: ENSSSCT00000029798
Sequence length	334
Comment	pep:novel chromosome:Sscrofa10.2:14:7872814:7883551:-1 gene:ENSSSCG00000025094 transcript:ENSSSCT00000029798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	WGQSAPTASGAPAGRAASPQPSLQDLRTLIVVVLVLSPLPLPVTVTAASGMPTGQGRFHQ QMAAPGAGSHSRWESCPPGFHVEDASGECVRCTDGVDYTSHPNTLFSCLRCTVCRSGEEE KTPCTATADTGCECKPGTFREENSPEFCQKCHTRCPDGMVMATPCTPSSDLKCVHQESGT RASGEALDPGEPVTTNLQPPTASSPSSTSCLVVLFLVVSACLIYKYKVQGLGLLVQYLSC PWGGRCCCGLHRKFMDKRSHPSRRPEALDNARNNTLSNRDGLSSPVSDQEVEDPEQVEPT GVQSSGEAEHLLEPAAAEGSRVRRRLLVPADGGD
Download sequence
Identical sequences	ENSSSCP00000019309 ENSSSCP00000019309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]