SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020055 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020055
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000248
Family Hairy Orange domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020055   Gene: ENSSSCG00000028552   Transcript: ENSSSCT00000030248
Sequence length 482
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:51429364:51435089:1 gene:ENSSSCG00000028552 transcript:ENSSSCT00000030248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDSKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLARFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPTTAPAGSVAAACLERAGQKLEPLAHCVPVIQRTQPSAELAAENDTDT
DSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGGGPGGGAAAA
AAALLGPDPAAATALLRPGAALLSSLVAFGGGGGAPFAQPAAAAAPFCLPFYFLSPSAAA
AYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAFPCLSSVLSP
PPEKAAAAAAATLLPHEVASPGALHPPHPHGRTHLPFAGPREPGNPESSAQEDHSQPGKE
SP
Download sequence
Identical sequences ENSSSCP00000020055 ENSSSCP00000020055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]