SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020519 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020519
Domain Number 1 Region: 3-235
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.49e-37
Family WD40-repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 949-1007
Classification Level Classification E-value
Superfamily HMG-box 0.000000236
Family HMG-box 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020519   Gene: ENSSSCG00000005052   Transcript: ENSSSCT00000027382
Sequence length 1066
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:204780489:204841492:-1 gene:ENSSSCG00000005052 transcript:ENSSSCT00000027382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVIFNEDGTKIAAGSSDFLVKVVDV
MDCSQQKTFRGHDAPVLSLSFDPKDIFLASSSCDGSVKVWQISDQTCAISWPLLQKCNDV
INAKSICRLAWQPKSGKLLAVPVEKSVKLYRRETWSNQFDLSDNFISQTLNIVTWSPCGQ
YLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLSWHPTCGQIAYTDAEGNLGLLENV
CDPNGKMSGSKVSSRVERDYNDLFDGDDTGNVGDFPNDNAVETHSFSKETRNDEEDDDDL
MLASGRPRQRSHILEDDENSVDVTMLKTGSSRLKEEEEDDQAGNIHSLPLITSQKPFYDG
PMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATHLSN
TLNYTVADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIVDMPPNEDIEAVCLGQG
WAAAATSSLLLRLFTIGGVQKEVFSLPGPVVSMAGHGEQLIIVYHRGTGFDGDQCLGIQL
LQLGKKKKQILHGDPLPLTRKSYLVWLGFSAEGTPCYVDSEGIVRMLNRGLGYTWTPICN
TREHCKGKSDHYWVVGIHENPQHLRCIPCKGSRFPPTLPRPAIAVLSFKLPYCQTGTEKG
QMEEQYWRSVLFHNHLDYLAKSGYEYEESTKNQAIKEQQELLMKMLALSCKLEREFRCVE
LADLMTQNAVNLAIKYASRSRRLILAQKLSELAVEKAAELAAPQAEEEEEEEEDFRKKLN
AGYSNTPTEWSQPRLRNRVEEDTEDTEEVDDIEEKPEIHKHRQNPFFKSADSTDVPAIKK
GAVTSSSQGRINPFKVNSFHKQNFCSLNISANTSLYYNMNKSKKSALNRATNNEKSPVIK
PLVPKPKSKQASAASFFQKRTSQTDKTEEIKEENTKNSSSETPAVCPQNTENQRPKTGFQ
MWLEENRSNILSDNPDFSDEADIIKEGMVRFRVLSAEERKAWAAKAKGGIASDGAEEKKR
KRVVDESHETENQEEKTKENLNLPKKQKPLNLSANQKLSAFAFKQE
Download sequence
Identical sequences ENSSSCP00000020519 ENSSSCP00000005431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]