SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021749 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021749
Domain Number 1 Region: 437-468,550-624
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021749   Gene: ENSSSCG00000025267   Transcript: ENSSSCT00000031952
Sequence length 672
Comment pep:novel chromosome:Sscrofa10.2:9:118242687:118270357:-1 gene:ENSSSCG00000025267 transcript:ENSSSCT00000031952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFTGLAFALLVTVPPGYGLYAAFFPVIIYFFLGTSRHISVGPFPVLSMMVGAVVVRLTPT
ADTADPTVSNSSVGNDSALDDHKVMVAATVTILSGIIQMLLGVLKLGFVVIYLSESLISG
FTTAAAVHVLVSQLKFMLQLTVPAHTDPFSLFKVLISVFSQIEKTNIADLVTSLVILFVV
FVVKEINQRYKAKLPVPIPIELIMTVIATGVSYGFDFKNRFKVAVIGEMKSGFQAPITPD
AQTLQDTIGDCFGIAVVGFAVAFSVASVYSLKYDYPIDGNQELIALGVSNICGGLFRGFA
ASTALSRSGVQESTGGKTQIAGLISAIIVLIVILAIGFLLEPLQKSVLAALALGNLKGML
MQFTEIRRLWRKDKYDCIIWIMTFIFAVVLGLGLGLAASVAFQLLTIVFRTQFPKCSMLA
NVGRSNIYKNRKDYSDIYEPEGVKIFRCPSPLYFANIGFFKRKLIDAVGFSPLRILRKRN
KALKKIRKLQKKGLLQVTPKGFICTVDCVKDSDEELDNDKIEELDQPINTTDLPFQIDWN
ADLPVNIVVPKISLHSLILDFSAVSFLDVSSMRGLKTILQEFIRIQVDVYIVGTDDDFIE
KLGRCEFFDDEVKDSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKGAKYDFTVNTNGGLR
NRECQVSVETKF
Download sequence
Identical sequences ENSSSCP00000021749 ENSSSCP00000021749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]