SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021766 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021766
Domain Number 1 Region: 73-412
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-87
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 947-1013
Classification Level Classification E-value
Superfamily G protein-binding domain 1.54e-22
Family RhoA-binding domain 0.000041
Further Details:      
 
Domain Number 3 Region: 1136-1223,1305-1336
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000135
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 1242-1291
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000113
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number 5 Region: 426-528
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000889
Family Myosin rod fragments 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021766   Gene: ENSSSCG00000021893   Transcript: ENSSSCT00000029907
Sequence length 1370
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:98713997:98861692:-1 gene:ENSSSCG00000021893 transcript:ENSSSCT00000029907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSAANPNDNRASSNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
LSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSITQLESLNRELQERNRILENSKSQTD
KDYYQLQAVLEAERRDRGRDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKDAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFESDNLKGLQKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHIVSRLEETNSMLTKDIDLLRKENE
ELTDKMRKAEEEYKLKKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQRAKLLDLSDSTSVASFPSADETDGNLPVDSACIPYLFIFYSYLLESRIEGW
LSIPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDV
YRAETEEIPKIFQILYANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEA
CAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDE
QKKWVTHLVKKIPKNPPSSFVRASPRTLSTRSTANQSFRKVVKNTSGKTR
Download sequence
Identical sequences ENSSSCP00000021766 ENSSSCP00000021766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]