SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021948 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021948
Domain Number 1 Region: 182-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.57e-58
Family Dystroglycan, domain 2 0.000000367
Further Details:      
 
Domain Number 2 Region: 479-579
Classification Level Classification E-value
Superfamily Cadherin-like 4.87e-19
Family Dystroglycan, N-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 2.2e-18
Family Dystroglycan, N-terminal domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021948   Gene: ENSSSCG00000030708   Transcript: ENSSSCT00000026336
Sequence length 877
Comment pep:known_by_projection scaffold:Sscrofa10.2:JH118489.1:81292:97231:1 gene:ENSSSCG00000030708 transcript:ENSSSCT00000026336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSAGLSLLIPLWGRTFLLLLSVAVTQSRWPSEPSDAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASGGEIIKVSAAGKEALPSWLHWDPQSHTLEGL
PLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHSEPQSVRAASPDPGEVVSS
VCAADEPVTVLTVILDADLTKMIPKQRLDLLQRMQSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVIENGALLSWKLGCSLNQNSVPDIHGVEVPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIFQTPTLGPIQPTRVSEAGTTVPGHIRPTMTIPGYLEPTAVATPP
TPTTKNPRVSXPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTTTSGLPRGEPNQRPE
LKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLREQQLVGVKSWVQFNSNS
QLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFTAKFVGDPAP
VVNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQITGLS
RRIAEDDGKPRAAFSNALEPDFKAMSIAVTGSGSCRHLQFVPVAPPKRVPSEAPPTEVPD
RDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPI
IFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQDTVGEYTPLRDEDP
NAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences Q29243
ENSSSCP00000021948 ENSSSCP00000021948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]