SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022084 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022084
Domain Number 1 Region: 212-295
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-18
Family Caspase recruitment domain, CARD 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000022084
Domain Number - Region: 9-85
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00794
Family Protein kinases, catalytic subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022084   Gene: ENSSSCG00000024096   Transcript: ENSSSCT00000026840
Sequence length 310
Comment pep:known chromosome:Sscrofa10.2:4:51490309:51504917:-1 gene:ENSSSCG00000024096 transcript:ENSSSCT00000026840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYICFDRSTNPLQIMYSVSQGHRPDTSEESLPFDIPHRALMISLIESGWAQNPDERPSF
LKCLIELEPVLRIFEDITFLEAVIQLKKTKLQSASSTVHLCDKKKTELYPNTSVNHGSQE
ESCGSSQLHKPSNSPGTSKSLSATQDSDFLSRKTQDFSTPRQCPVNRSWDSNISVAQRAT
FCDHKTTPCSLAIINPLSAEGNSERFQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLS
RDLIMKEDYELISTKPTRTSKVRQLLDTTDIQGEEFARVIVQKLKDNKQMGLQPYPEILV
VSRPPSLNLF
Download sequence
Identical sequences ENSSSCP00000022084 ENSSSCP00000022084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]