SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022424 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022424
Domain Number 1 Region: 33-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.56e-37
Family SCAN domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-24
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 3 Region: 288-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022424   Gene: ENSSSCG00000022664   Transcript: ENSSSCT00000025146
Sequence length 346
Comment pep:novel chromosome:Sscrofa10.2:7:23730894:23744506:1 gene:ENSSSCG00000022664 transcript:ENSSSCT00000025146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSLEAEEQKALLIVKAEDWRQDSTSGKYSPHRRELFRQHFRKLCYQDAPGPREALTQL
SELCHQWLRPECHTKEQILDLLVLEQFLSILPKDLQAWVQAHHPETGEDAVTVLEDLERE
LDEPQKQVPANSERQDTLLNKLAALRRPRESLTIKFHPRKTQQEQESGEPQRNGDQTRTK
NEELSQKEDIPKDMKFLGEINNRSNKDTPQYPESKDAVESEGRFEWQQRERRRYKCDDCG
KSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKDFS
GRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY
Download sequence
Identical sequences ENSSSCP00000001267 ENSSSCP00000022424 9823.ENSSSCP00000001267 ENSSSCP00000001267 ENSSSCP00000022424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]