SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023118 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023118
Domain Number 1 Region: 44-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-38
Family SCAN domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-27
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 361-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023118   Gene: ENSSSCG00000022999   Transcript: ENSSSCT00000024599
Sequence length 438
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:53900476:53905605:1 gene:ENSSSCG00000022999 transcript:ENSSSCT00000024599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAASLTAAKMLALQGTGDQEKIMMMETREEKQAWKRETGLRGNYSPSQEIFRQRFRQLCY
QEAPGPREALRRLRALCCEWLRPERHTKEQILEFLVLEQFLTILPEELQSRVRGHHPQSA
EEAVTVLEDLEKGHDEPGPQVPGPARGPAQQEPREEKAPLGAAQEKAGIQLQPRDTRPFP
ESEQVYLHFQSVIAEDDAEPEDKGSLPQPPIAEVEAQVLREKLTSSTSTFEGASEAEAPF
EEQQRNLRGERPRRPPARGKSFGQMVVTHKTPPPGKKDHECLECGKAFIYNSHLIIHQRI
HSGEKPYKCSDCGKTFNQSSNLIQHQRIHTGEKPYECRECGKAFRWSAHLVQHQRIHSGE
KPFECNECGKAFSQSSYLSQHLRIHSGEKPFLCRECGKAYRWSSELVRHQRVHAGKEPFA
GTQGRKPPDRTGLLSNQF
Download sequence
Identical sequences ENSSSCP00000023118 ENSSSCP00000023118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]