SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023945 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023945
Domain Number 1 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 9-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 263-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 164-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 118-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000381
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023945   Gene: ENSSSCG00000023892   Transcript: ENSSSCT00000024404
Sequence length 330
Comment pep:known scaffold:Sscrofa10.2:JH118996.1:122284:126308:1 gene:ENSSSCG00000023892 transcript:ENSSSCT00000024404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVLSTLLHWMLESVTFEDVAIDFSQEEWALLDTSQRKLFRDVMLENINHLVSLGTGYHHS
KSDVIFHLEQGEELWFEGRGFFQSHSPGRESALKEEMLATWNISSKDTSTIIPVQVSHTP
EDPFECNDLGEDFIYSSTLSQHLLTHMEKIPCISKQCQKPLSDQSYLNQHKQIHTRGKSC
ECHLCGKAFSNCSSLRRHEMTHTGEKPYECHICGNAFIQSSDLRKHNLTHTGEKPYECHL
CGKAFSQSSNLRQHERTHTGEQPYECQLCGKAFSKCSALRRHERTHTGEKPYECHLCGKS
FSQCSALRRHEGTHNGEKSMNAFSKYSDLR
Download sequence
Identical sequences ENSSSCP00000023945 ENSSSCP00000023945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]