SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024297 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024297
Domain Number 1 Region: 236-413
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-29
Family RUN domain 0.016
Further Details:      
 
Domain Number 2 Region: 1-73
Classification Level Classification E-value
Superfamily RUN domain-like 1.31e-22
Family RUN domain 0.0016
Further Details:      
 
Domain Number 3 Region: 83-178
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.73e-17
Family Lipoxigenase N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024297   Gene: ENSSSCG00000026593   Transcript: ENSSSCT00000024435
Sequence length 419
Comment pep:novel chromosome:Sscrofa10.2:5:45982550:46005363:-1 gene:ENSSSCG00000026593 transcript:ENSSSCT00000024435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQLLTKKLYKRYAFLRCEEEREQFLYH
LLSLNAVDYFCFTSVFTTIMIPYRAVIIPIKKLSNAIITSNPWICVSGELGDTGVMQIPK
NLLEMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGID
DGSLERILIGELMTSAADEDLVKQCRTPPQQKSPTMARRLSITSLTGKSTKPNAGQIQEG
IGEAVNNIVKHFHKPEKERGSLTVLLCGESGLVAALEQVFHHGFKSARIFHKNVFIWDFI
EKAVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGKDGKFQILVCLGTRD
RLLPQWIPLLAECPAITRMYEESALLRDRMTVNSLIRILQTIQDFTIVLEGSLIKGVDV
Download sequence
Identical sequences ENSSSCP00000024297 ENSSSCP00000024297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]