SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024741 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024741
Domain Number 1 Region: 328-719
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.7e-126
Family Oxysterol-binding protein 0.0000371
Further Details:      
 
Domain Number 2 Region: 74-194
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-24
Family Pleckstrin-homology domain (PH domain) 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024741   Gene: ENSSSCG00000027503   Transcript: ENSSSCT00000029484
Sequence length 819
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:43258240:43315842:-1 gene:ENSSSCG00000027503 transcript:ENSSSCT00000029484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGFERGKEDISQNKDESSVSMSKSKSESKLYNGSEKDNSASSKLTKKESLKVQKKNYREE
KKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTQKNGQWVGTV
LLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRATSES
DGRCWMDALELALKCSSLLKRTMIREGKEHDLSISSDSTHVTLYGLLRANNLHSGDNFQL
NDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEGMGKSEESDTDTSERQDDSYIEPEPV
EPLKETTYTEQSHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDLSRVVLPTFILE
PRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGLKKPYNPILGET
FRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKSKFYGNSLSAIL
EGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGTVNITCQKTGYSAILEFKLKKP
FLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFINDKKTDNSEVFWNPTPDIKQWRLIR
HTVKFEEQGDFESEKLWHRVTRAINAKDQTEATQEKYVLEEAQRQAARDRKTKNEEWTCK
LFELDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVPKMKHKPTRQQ
KKVAKGYSSPEPDIQDSSGSEAQSVKPSARRKKGIELGDIQTSIESIKQTQEEIKRNIMA
LRNHLISSTPATDYFLQQKDYFIIFLLILLQVIINFMFK
Download sequence
Identical sequences ENSSSCP00000024741 ENSSSCP00000024741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]