SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024778 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024778
Domain Number 1 Region: 203-332
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 7.06e-55
Family Retrovirus capsid protein, N-terminal core domain 0.00000283
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 3.83e-43
Family MMLV matrix protein-like 0.00000739
Further Details:      
 
Domain Number 3 Region: 473-516
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000598
Family Retrovirus zinc finger-like domains 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024778
Domain Number - Region: 342-372
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00366
Family Retrovirus capsid protein C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024778   Gene: ENSSSCG00000024446   Transcript: ENSSSCT00000026108
Sequence length 524
Comment pep:novel chromosome:Sscrofa10.2:3:53617315:53618889:1 gene:ENSSSCG00000024446 transcript:ENSSSCT00000026108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTVTTPLSLTLDHWTEVRSRAHNLSVQVKKGPWQTFCASEWPTFDVGWPSEGTFNSEI
ILAVKAIIFQTGPSSHPDQEPYILTWQDLAEDPPPWVKPWLNKPRKPGPRILALGEKNKH
SAEKVEPSPRIYPEIEEPPTWPEPQPVPPPPYPAQGAVRGPSAPPGAPVVEGPAAGTRSR
RGATPERTDEIAILPLRTYGPPMPGGQLQPLQYWPFSSADLYNWKTNHPPFSEDPQRLTG
LVESLMFSHQPTWDDCQQLLQTLFTTEERERILLEARKNVPGADGRPTQLQNEIDMGFPL
TRPGWDYNTAEGRESLKIYRQALVAGLRGASRRPTNLAKVREVMQGPNEPPSVFLERLME
AFRRFTPFDPTSEAQKASVALAFIGQSALDIRKKLQRLEGLQEAELRDLVREAEKVYYRR
ETEEEKEQRKEKEREEREERRDRRQEKNLTKILAAVVEGKSSRERERDFRKIRSGPRQSG
NLGNRTPLDKDQCAYCKEKGHWARNCPKKGNKGPKVLALEEDKD
Download sequence
Identical sequences C0IV21 F6KPU1 F8S326
ENSSSCP00000019160 ENSSSCP00000024113 ENSSSCP00000024778 C0IV21_9GAMR ENSSSCP00000019160 ENSSSCP00000024113 ENSSSCP00000024778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]