SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 76_10.2 > ENSSSCP00000026086

Domain assignment for ENSSSCP00000026086 from Sus scrofa 76_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000026086
Domain Number 1	Region: 9-151
Classification Level	Classification	E-value
Superfamily	TRADD, N-terminal domain	1.96e-55
Family	TRADD, N-terminal domain	0.000000575
Further Details:

Domain Number 2	Region: 192-279
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.000000000000016
Family	DEATH domain, DD	0.0057
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000026086 Gene: ENSSSCG00000024182 Transcript: ENSSSCT00000027163
Sequence length	283
Comment	pep:known_by_projection scaffold:Sscrofa10.2:GL896501.1:3469:6207:1 gene:ENSSSCG00000024182 transcript:ENSSSCT00000027163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	XAAGPNGLEEWVGSAYLFVESSLDKVVLSESYAHQQHKAAVYRALRTALAESGGSPEELQ MLKIHRSDPQLIVQLRFCGRQACSRFQACLEAALALSSVPLQLELRASAERLDALLTDEE RCLNFIFAQKPDRLRDEELTELEDALRNLTCGSGGQGGDVEGAPATSTXGQTFLFQGQPV VNRPLSLQDQLTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLL RRFVQAEGRRATLQRLVEALEENELTSLAEGLLGLANPDGSLA
Download sequence
Identical sequences	ENSSSCP00000026086 ENSSSCP00000026086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]