SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026681 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026681
Domain Number 1 Region: 269-506
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-76
Family Caspase catalytic domain 0.000000626
Further Details:      
 
Domain Number 2 Region: 16-122
Classification Level Classification E-value
Superfamily DEATH domain 2.83e-25
Family DEATH effector domain, DED 0.0029
Further Details:      
 
Domain Number 3 Region: 110-187
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000365
Family DEATH effector domain, DED 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026681   Gene: ENSSSCG00000026940   Transcript: ENSSSCT00000025501
Sequence length 520
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:116127712:116207636:1 gene:ENSSSCG00000026940 transcript:ENSSSCT00000025501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAQGQSLSSDDYCQMDFRGKLLIIDSNLGDQDVERLKFLCRDHISSRSLERSNSAVDIF
DQLMTEELLSEEDTFFLAELLYTIKQNSLLRHLHYTKEQVACLLPTRRKVSLFRNLLYEL
SEDISSENLKGMTFLLRESIPRVQMTSLSLLSYLEKQDQIDEDNLTLLEDVCKKIAPNLM
RKIEKYKREKASQVVTPPSAEETESLPQGKEELFSPSDIKHLLGSLQEGSQQDEHAGSNG
ETATPVSVELLGASVETLTSKSSTKETAVYRMDRNHRGFCVVVNNHRFTSMSERPGTHKD
AECLRRVFEWLGFSVHVYVDVTKVHLMQVLQKYQSHPGHADGDCFVFCVLTHGEFGAIYS
SDGDLIPIREILSHFTAQQCPGLAHKPKLFFIQACQGEEIQPSVSIEADAVNPELKAPLL
KDSIPVEADFLLGLATVPGYVSFRHVKEGSWYIQSLYNHLKDLVPRREDILSILTAVNND
VSRQVDKRGSKKQMPQPAFTLRKKSYSLCHRKSFYCSSEF
Download sequence
Identical sequences I3LRE7
ENSSSCP00000026681 ENSSSCP00000026681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]