SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027534 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027534
Domain Number 1 Region: 1110-1305
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 898-1021
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-31
Family Pleckstrin-homology domain (PH domain) 0.000000552
Further Details:      
 
Domain Number 3 Region: 19-47,76-147
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027534   Gene: ENSSSCG00000011074   Transcript: ENSSSCT00000029464
Sequence length 1917
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:56044599:56132190:1 gene:ENSSSCG00000011074 transcript:ENSSSCT00000029464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSDEVSKSKDGKEQSETVSPSEDETFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQ
FSYKDEENGNRGGGARKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIG
KTYSQVIALIQNSDTTLELSVMPKDEDILQVAYSQDAYLKGNEAYSGNARNIPEPPPICY
PWLPSAPSAMAQPAEAAPADSPSSKQQTSPPVLTQPSRAYRMEIQVPPSPPDVAKSNTAV
CVFNESVRTVIVPSEKVVDLLPNRNNHTVPSHRTEEVRYGRNEQTPLKVAPRTTSPPASV
PTAHLIHQTGSRSLEPSGILLKSGNYSGHSEGLSSSRAPAVDSPPVSVNHYSPNSHQHID
WKNYKTYKEYIDNRRLHMGCRTIQERLDSLRAASQSTAGYNPVVLNRTALQVRRRSTSQD
RAPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPSISFSNHRTRSWDYIEGQGET
LENIPSEHQLPDSSGERKPTYKWSGFTEQDDRRGIHERPRQQEIHKSFRGSNFTVAPSMV
NSDSRRFKKIPPELKTLQPNRNFQTTCGMSQPRGVSQDRSPLVKVRSNSLKAPSTHVTKP
PSSQNSFVSIKDQRPVNHLHQNSLLNQQTWLRTESAPDHQVDTGKPPSLSGASVKPIPPV
SENAGTPDLELSGTQRNQDLNLQEAEIQQSNTVDNKDTVILREKPPSGRQTPQPLRHQSY
ILAVNDQETGSDTTCWLPNDARREVHIKRMEERKASSTSPPGDSLASIPFIDEPTSPSID
HDISHIPASAVISASTSQVPSIATVPPSLTTSAPLIRRQLSHDQESVGPPSLDAQPSSKT
ERSKSYDEGLDDYREDAKLSFKHVSSLKGIKIMDSQKSSEDSGSRKDSSSEVFSDAAKEG
WLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKEKREQTAPSEEEQPISVNACLI
DISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSTLNEEDTGVTNRDLISR
RIKEYNSLMSSKAEQLPKTPRQSLSIRQTLLGAKAEPRTQSPHSPKEESERKLLSKEDDT
SPPKDKGTWRKGIPSIMRKTFEKKPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEE
RGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPL
FTNDKYADFIEANRKEDPLDRLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKME
PRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEE
STVDSQPVPNIDHLLTNIGRTGVPPGDVSDSATSDSTKSKGSWGSGKDQYSRDLLVSSIF
AAASRKRKKPKEKAQPSSSEDELDNVFFKKENAEQCPNDIKEESKKESETVGRKQRLITS
KETNTKKDTSAAKEDQGAGQRESAPAGEPSAPSCSKSPTPSRRLAVLRESPKPLVAPKSS
FFEETGSDSGALLSTCSQASLARFPTKKSTSPDTKPSEFLATVITITSDDATASPVPYWS
NLDSSRLSPEVQSVAESRGEEADDERSELVSEGRPVETDSESDFPVFPTALTSERLLRGK
LQEATKTSRRNSEGSEVSCTEGSLTPSLESRRQLFSSHKLIECDTLSRKKSARFKSDSGS
LGDAKNEKETPSIAKVFDVMKKGKSTGSLLTAPTRSETEKQEPTWKTKIADRLKLRSKAP
ADDMFGVGNQKPNADPAKRKNIKRRHTLGGHRDAAEISVLNFWKAQEQSGEREGELSAVN
RLKPKCSAQDLSISDWLARERSRTSAADAGDPQPESAGTLEIPTADPPLSFQPHAVGPSS
TLASTDRALLSTPPESPDQINGESFQNTIHHAGSAATAQPHKLSETPGTKAQCHPCL
Download sequence
Identical sequences ENSSSCP00000027534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]