SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027946 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027946
Domain Number 1 Region: 75-170
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000883
Family DEATH domain, DD 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027946   Gene: ENSSSCG00000027790   Transcript: ENSSSCT00000032569
Sequence length 187
Comment pep:known chromosome:Sscrofa10.2:13:108078842:108090547:-1 gene:ENSSSCG00000027790 transcript:ENSSSCT00000032569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFKLLLVEKDSEEIVWKAKLRECDWVQHDQNQNVSKSNTSGNRRRKMSSSLPDEVVYDK
RMKQFDTSDGAKTKTLLTDTQLFDLAEKLGKEWMKIAIANLKLKMSDIDAILEKKEDVTM
NKFRMLKKWQEKEKSNATAQNLCNCLKNVDSVEVQDVLKGFLQESLEVELEEEASGTVFC
EDPLCGN
Download sequence
Identical sequences ENSSSCP00000027946 ENSSSCP00000027946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]