SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028809 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028809
Domain Number 1 Region: 166-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000812
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 122-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 3 Region: 71-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000028809
Domain Number - Region: 34-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family Merozoite surface protein 1 (MSP-1) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028809   Gene: ENSSSCG00000013775   Transcript: ENSSSCT00000034597
Sequence length 208
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:65098520:65108927:1 gene:ENSSSCG00000013775 transcript:ENSSSCT00000034597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGPHHGVFLLFHVLCVSLTLSEVGAQSTKACARWCPLNSSCVNSTACRCNLGFSASSGE
VFTSPSDSCDDINECAPPTTVSCGKNADCQNTEGGYHCTCVPGYELASGAPIFRNENENT
CQDVNECTPGSNPCHNSTHCFNLVGRYECRCRPGWKPIPGSPNGPNNTICEDKDECSSGE
HKCHNSTICTNTVGSYACHCRRGWVPKP
Download sequence
Identical sequences ENSSSCP00000028809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]