SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028838 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028838
Domain Number 1 Region: 147-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-100
Family Protein kinases, catalytic subunit 0.0000000000167
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-25
Family Pleckstrin-homology domain (PH domain) 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028838   Gene: ENSSSCG00000002989   Transcript: ENSSSCT00000036184
Sequence length 481
Comment pep:novel chromosome:Sscrofa10.2:6:44331702:44378012:-1 gene:ENSSSCG00000002989 transcript:ENSSSCT00000036184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGAGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLTVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences A0A0B8RZS0 G9BWQ2
NP_001243708.1.46622 ENSSSCP00000028838 ENSSSCP00000003238 9823.ENSSSCP00000003238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]